« Zurück
Home /
TRADD Rabbit pAb

TRADD Rabbit pAb

ArtNr	A1145-20ul
Hersteller	Abclonal
Menge	20ul
Kategorie	Antibodies Cell Biology Cell Status Apoptosis Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
NCBI	Tradd
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	TRADD;Hs.89862
Lieferbar
Background	Predicted to enable death domain binding activity; identical protein binding activity; and signaling receptor binding activity. Involved in positive regulation of hair follicle development. Acts upstream of or within extrinsic apoptotic signaling pathway. Located in cytoplasm. Is expressed in adrenal gland; genitourinary system; liver; lung; and spleen. Orthologous to human TRADD (TNFRSF1A associated via death domain).
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 199-312 of human TRADD (NP_003780.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:1000 - 1:5000
Protein Size	34kDa
Manufacturers Research Area	Cancer, Invasion and Metastasis, Signal Transduction, MAPK-JNK Signaling Pathway, MAPK-P38 Signaling Pathway, Cell Biology & Developmental Biology, Apoptosis, Death receptors & ligands, Inhibition of Apoptosis, Growth factor, TNF, Death Receptor Signaling Pathway, Immunology & Inflammation, NF-kB Signaling Pathway, Cardiovascular
Gene Symbol	Tradd

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20ul

lieferbar

Lieferung vsl. bis 25.10.2024

Express-Lieferung: 23 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail