« Zurück
Home /
DVL1 Rabbit pAb

DVL1 Rabbit pAb

ArtNr	A10536-100ul
Hersteller	Abclonal
Menge	100ul
Kategorie	Antibodies Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	GQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRE
NCBI	DVL1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	DVL1;DRS2;DVL;DVL1L1;DVL1P1
Lieferbar
Background	DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 510-640 of human DVL1 (NP_004412.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	75kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Signal Transduction, mTOR Signaling Pathway, Cell Biology Developmental Biology, Wnt ��-Catenin Signaling Pathway, Stem Cells
Gene Symbol	DVL1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 22 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail