« Zurück
Home /
Raptor Rabbit pAb

Raptor Rabbit pAb

ArtNr	A16309-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
NCBI	RPTOR
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	KOG1;Mip1;RPTOR
Lieferbar
Background	This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene.
Route	Recombinant protein
Manufacturers Category	Polyclonal Antibodies
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 888-1013 of human RPTOR (NP_065812.1).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	149kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Translation Control, Regulation of eIF4 and p70 S6 Kinase, Signal Transduction, PI3K-Akt Signaling Pathway, mTOR Signaling Pathway, Cell Biology Developmental Biology, Autophagy, Cell Cycle, Cell cycle inhibitors, Endocrine Metabolism, AMPK Signaling Pathway, Insulin Receptor Signaling Pathway, Immunology Inflammation, T Cell Receptor Signaling Pathway
Gene Symbol	RPTOR

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 23 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail