« Zurück
Home /
RB Rabbit pAb

RB Rabbit pAb

ArtNr	A11409-100ul
Hersteller	Abclonal
Menge	100ul
Kategorie	Oncology Antibodies Western Blot Primary Antibodies By Organ Bladder Cancer
Typ	Antibody Polyclonal
Applikationen	WB, IF, ICC, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MNSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENL
NCBI	RB1
ECLASS 5.1	32160702
ECLASS 6.1	32160702
ECLASS 8.0	32160702
ECLASS 9.0	32160702
ECLASS 10.0.1	32160702
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	OSRC;PPP1R130;RB;p105-Rb;pRb;pp110;RB1;Rb
Lieferbar
Background	The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.
Route	Synthetic peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 300-400 of human RB (NP_000312.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:1000\|IF/ICC, 1:100 - 1:200
Protein Size	106kDa
Manufacturers Research Area	Epigenetics Nuclear Signaling, Transcription Factors, DNA Damage Repair, Protein phosphorylation, Cancer, Tumor suppressors, Cell Biology Developmental Biology, Cell Cycle, Cell cycle inhibitors, Cell Cycle Control-G1 S Checkpoint
Gene Symbol	RB1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail