« Zurück
Home /
Integrin beta 3 (ITGB3/CD61) Rabbit mAb

Integrin beta 3 (ITGB3/CD61) Rabbit mAb

ArtNr	A19073-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Antibodies Immunohistochemistry Western Blot Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, FC, IP, ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	CVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
NCBI	ITGB3
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	BDPLT16;BDPLT2;CD61;GP3A;GPIIIa;GT;Integrin beta 3;ITGB3
Similar products	CD61, Integrin beta 3, ITGB3, GT, GP3A, GPIIIa, BDPLT2, BDPLT16
Lieferbar
Background	The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.
Route	Synthetic Peptide
Manufacturers Category	Monoclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 689-788 of human Integrin beta 3 (ITGB3/CD61) (P05106).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000\|IHC-P, 1:50 - 1:200\|IP, 1:500 - 1:1000\|FC(Intra), 1:50 - 1:200
Protein Size	87kDa
Manufacturers Research Area	Cancer, Invasion and Metastasis, Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, PI3K-Akt Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Cell Adhesion, Cytoskeleton, Immunology Inflammation, CDs, Cardiovascular, Angiogenesis, Blood, Cardiovascular diseases
Gene Symbol	ITGB3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail