« Zurück
Home /
THBS1 Rabbit pAb

THBS1 Rabbit pAb

ArtNr	A16985-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Neuroscience Molecular Targets for Neuroscience Antibodies Immunohistochemistry Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	ELISA, IHC-P
Specific against	Human
Host	Rabbit
Isotype	IgG
Purity	Affinity purification
Sequence	TGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS
NCBI	THBS1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	THBS1;THBS;THBS-1;TSP;TSP-1;TSP1
Similar products	THBS1, TSP, TSP1, TSP-1, THBS, THBS-1
Lieferbar
Background	The protein encoded by this gene is a subunit of a disulfide-linked homotrimeric protein. This protein is an adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. This protein can bind to fibrinogen, fibronectin, laminin, type V collagen and integrins alpha-V/beta-1. This protein has been shown to play roles in platelet aggregation, angiogenesis, and tumorigenesis.
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human THBS1 (NP_003237.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Recommended Dilution	IHC-P, 1:50 - 1:200
Protein Size	129kDa
Manufacturers Research Area	Cancer, Invasion and Metastasis, Cell Biology Developmental Biology, Cell Adhesion, Endocrine Metabolism, Neuroscience, Cell Type Marker, Stem Cells, Cardiovascular, Angiogenesis, Blood, Hypoxia, Astrocyte marker
Gene Symbol	THBS1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 27.09.2024

Express-Lieferung: 23 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail