ArtNr |
A16792-20ul |
Hersteller |
Abclonal
|
Menge |
20ul |
Kategorie |
|
Typ |
Antibody Polyclonal |
Applikationen |
WB, ELISA |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Purity |
Affinity purification |
Sequence |
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKD |
NCBI |
CASP1 |
ECLASS 10.1 |
32160702 |
ECLASS 11.0 |
32160702 |
UNSPSC |
12352203 |
Alias |
CASP1;ICE;IL1BC;P45;caspase-1;Caspase 1 |
Similar products |
CASP1, Caspase 1, ICE, IL1BC, P45, caspase-1 |
Lieferbar |
|
Background |
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms. |
Route |
Recombinant Protein |
Manufacturers Category |
Polyclonal Antibodies |
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 120-297 of human Caspase-1 (NP_150634.1). |
Storage |
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:100 - 1:500 |
Protein Size |
45kDa |
Manufacturers Research Area |
Cancer, Invasion and Metastasis, Signal Transduction, ErbB-HER Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Caspases, Endocrine Metabolism, Immunology Inflammation, Neuroscience, Neurodegenerative Diseases |
Gene Symbol |
CASP1 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.