« Zurück
Home /
CHPT1 Rabbit pAb

CHPT1 Rabbit pAb

ArtNr	A16137-200ul
Hersteller	Abclonal
Menge	200ul
Kategorie	Antibodies Western Blot Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, ELISA
Specific against	Human
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MAAGAGAGSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLWMAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLC
NCBI	CHPT1
ECLASS 5.1	32160702
ECLASS 6.1	32160702
ECLASS 8.0	32160702
ECLASS 9.0	32160702
ECLASS 10.0.1	32160702
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CHPT1;CPT;CPT1
Lieferbar
Background	Enables diacylglycerol cholinephosphotransferase activity. Involved in phosphatidylcholine biosynthetic process and platelet activating factor biosynthetic process. Predicted to be located in Golgi membrane. Predicted to be active in Golgi apparatus and endoplasmic reticulum membrane.
Route	Synthetic Peptide
Manufacturers Category	Polyclonal Antibodies
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHPT1 (NP_064629.2).
Storage	Store at -20℃. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	45kDa
Manufacturers Research Area	Cancer, Cell Biology Developmental Biology, Cell Cycle, Cell differentiation, Endocrine Metabolism, Lipid Metabolism, Cardiovascular, Lipids, Fatty Acids
Gene Symbol	CHPT1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ul

lieferbar

Lieferung vsl. bis 23.08.2024

Express-Lieferung: 11 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail