Vergleich

GluR2/GRIA2 Rabbit mAb Europäischer Partner

ArtNr A11316-20ul
Hersteller Abclonal
Menge 20ul
Kategorie
Typ Antibody Monoclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Human
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence YLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKI
NCBI GRIA2
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias GLUR2, GLURB, GluA2, GluR-K2, HBGR2
Similar products GLUR2, GLURB, GluR-K2, HBGR2, GluA2
Lieferbar
Background
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to a family of glutamate receptors that are sensitive to alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA), and function as ligand-activated cation channels. These channels are assembled from 4 related subunits, GRIA1-4. The subunit encoded by this gene (GRIA2) is subject to RNA editing (CAG-> CGG; Q-> R) within the second transmembrane domain, which is thought to render the channel impermeable to Ca(2+). Human and animal studies suggest that pre-mRNA editing is essential for brain function, and defective GRIA2 RNA editing at the Q/R site may be relevant to amyotrophic lateral sclerosis (ALS) etiology. Alternative splicing, resulting in transcript variants encoding different isoforms, (including the flip and flop isoforms that vary in their signal transduction properties), has been noted for this gene.
Route
Synthetic Peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GluR2/GRIA2 (P42262).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
99kDa
Manufacturers Research Area
Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease, Dopamine Signaling in Parkinson's Disease
Gene Symbol
GRIA2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen