ArtNr |
A0121-200ul |
Hersteller |
Abclonal
|
Menge |
200ul |
Kategorie |
|
Typ |
Antibody Monoclonal |
Applikationen |
WB, IF, ICC, ELISA, IHC-P |
Specific against |
Human |
Host |
Rabbit |
Isotype |
IgG |
Konjugat/Tag |
Unconjugated |
Purity |
Affinity purification |
Sequence |
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL |
NCBI |
CCR7 |
ECLASS 10.1 |
42030590 |
ECLASS 11.0 |
42030590 |
UNSPSC |
12352203 |
Alias |
BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1 |
Similar products |
CCR-7, CMKBR7, EBI1, BLR2, CDw197, CD197, CC-CKR-7 |
Lieferbar |
|
Background |
The protein encoded by this gene is a member of the G protein-coupled receptor family.This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes.This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes.It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation.The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor.Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis.Alternative splicing of this gene results in multiple transcript variants. |
Route |
Synthetic Peptide |
Manufacturers Category |
Monoclonal Antibodies |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248). |
Storage |
Store at -20℃.Avoid freeze/thaw cycles.|Buffer:PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Recommended Dilution |
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200 |
Protein Size |
43kDa |
Manufacturers Research Area |
Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Immunology Inflammation, CDs, Cell Intrinsic Innate Immunity Signaling Pathway |
Gene Symbol |
CCR7 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.