Vergleich

CCR7 Rabbit mAb Europäischer Partner

ArtNr A0121-200ul
Hersteller Abclonal
Menge 200ul
Kategorie
Typ Antibody Monoclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Human
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL
NCBI CCR7
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias BLR2, CC-CKR-7, CCR-7, CD197, CDw197, CMKBR7, EBI1
Similar products CCR-7, CMKBR7, EBI1, BLR2, CDw197, CD197, CC-CKR-7
Lieferbar
Background
The protein encoded by this gene is a member of the G protein-coupled receptor family.This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes.This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes.It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation.The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor.Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis.Alternative splicing of this gene results in multiple transcript variants.
Route
Synthetic Peptide
Manufacturers Category
Monoclonal Antibodies
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR7 (P32248).
Storage
Store at -20℃.Avoid freeze/thaw cycles.|Buffer:PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
43kDa
Manufacturers Research Area
Signal Transduction, G protein signaling, G-Protein-Coupled ReceptorsGPCR, Immunology Inflammation, CDs, Cell Intrinsic Innate Immunity Signaling Pathway
Gene Symbol
CCR7

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen